PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G154100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 281aa    MW: 32049.1 Da    PI: 6.3123
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G154100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.7e-163582148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg WT+eEd ll  ++k++G  +W+  +++ g+ R++k+c++rw +yl
  Aqcoe1G154100.1.p 35 RGTWTPEEDRLLTAYIKRYGHWNWRELPKYAGLSRCGKSCRLRWMNYL 82
                       89******************99************************97 PP

2Myb_DNA-binding58.71.3e-1888133148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg  T eEdel+++++++lG++ W++Ia++++ gRt++++k++w+++l
  Aqcoe1G154100.1.p  88 RGDYTREEDELIINLHAELGNR-WSAIAARLP-GRTDNEIKNHWHTHL 133
                        7889******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.1293082IPR017930Myb domain
SuperFamilySSF466893.28E-3032129IPR009057Homeodomain-like
SMARTSM007178.9E-133484IPR001005SANT/Myb domain
PfamPF002493.2E-143582IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-233689IPR009057Homeodomain-like
CDDcd001672.14E-103782No hitNo description
PROSITE profilePS5129426.89683137IPR017930Myb domain
SMARTSM007172.0E-1787135IPR001005SANT/Myb domain
PfamPF002494.8E-1788133IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.0E-2790136IPR009057Homeodomain-like
CDDcd001673.14E-1391133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MMILMHNSSK ASVKTCNVLQ DMGRSSICEK TGLTRGTWTP EEDRLLTAYI KRYGHWNWRE  60
LPKYAGLSRC GKSCRLRWMN YLRPNIKRGD YTREEDELII NLHAELGNRW SAIAARLPGR  120
TDNEIKNHWH THLQKRTKRT TIVKEAKPKP NIEHGAVGRR ESAVPNCVHP NDITPLILES  180
SAVIPISPPK SSDFSSSSTY DSEVVISENQ GITDDSEISS DGFIEYDGNF WTEPFLVEDS  240
YKVNDTMPVF VNEYSVSPLA EALYPYDLYN GCDMDMLFNY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27331375108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479764.16e-77PREDICTED: myb-related protein Myb4-like
TrEMBLA0A0D2RIS26e-77A0A0D2RIS2_G
STRINGVIT_12s0134g00480.t015e-74(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G23250.11e-61myb domain protein 15